The domain within your query sequence starts at position 1087 and ends at position 1236; the E-value for the Ferric_reduct domain shown below is 5.3e-21.

RGTAASISFMFSYILLTMCRNLITFLRETFLNRYIPFDAAVDFHRLIASTAIILTVLHSA
GHVVNVYLFSISPLSVLSCLFPGLFHDDGSEFPQKYYWWFFQTVPGLTGVLLLLALAIMY
VFASHHFRRRSFRGFWLTHHLYIFLYILLI

Ferric_reduct

Ferric_reduct
PFAM accession number:PF01794
Interpro abstract (IPR013130):

This domain represents a common region in the transmembrane proteins mammalian cytochrome B-245 heavy chain (gp91-phox), ferric reductase transmembrane component in yeast and respiratory burst oxidase from mouse-ear cress. These proteins may be a family of flavocytochromes capable of moving electrons across the plasma membrane [(PUBMED:8321236)]. The Frp1 protein Q04800 from Schizosaccharomyces pombe is a ferric reductase component and is required for cell surface ferric reductase activity. Mutants in Frp1 are deficient in ferric iron uptake [(PUBMED:8321236)]. Cytochrome B-245 heavy chain P04839 is a FAD-dependent dehydrogenase it is also has electron transferase activity which reduces molecular oxygen to superoxide anion, a precursor in the production of microbicidal oxidants [(PUBMED:1318579)]. Mutations in the sequence of cytochrome B-245 heavy chain (gp91-phox) lead to the X-linked chronic granulomatous disease. The bacteriocidal ability of phagocytic cells is reduced and is characterised by the absence of a functional plasma membrane associated NADPH oxidase [(PUBMED:3600768)]. The chronic granulomatous disease gene codes for the beta chain of cytochrome B-245 and cytochrome B-245 is missing from patients with the disease [(PUBMED:3600769)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Ferric_reduct