The domain within your query sequence starts at position 4 and ends at position 212; the E-value for the Flavodoxin_2 domain shown below is 3.5e-55.

KKVLIVYAHQEPKSFNGSLKKVAVEELSKQGCTVTVSDLYSMNFEPRATRNDITGAPSNP
DVFSYGIETHEAYKKKALTSDIFEEQRKVQEADLVIFQFPLYWFSVPAILKGWMDRVLCR
GFAFDIPGFYDSGFLKGKLALLSLTTGGTAEMYTKDGVSGDFRYFLWPLQHGTLHFCGFK
VLAPQISFGLDVSSEEERKVMLASWAQRL

Flavodoxin_2

Flavodoxin_2
PFAM accession number:PF02525
Interpro abstract (IPR003680):

This entry represents a domain with a flavodoxin-like fold.

Proteins with this domain include bacterial and eukaryotic NAD(P)H dehydrogenase (quinone) EC 1.6.99.2. These enzymes catalyse the NAD(P)H-dependent two-electron reductions of quinones and protect cells against damage by free radicals and reactive oxygen species [(PUBMED:2168383)]. This enzyme uses a FAD cofactor. The equation for this reaction is NAD(P)H + acceptor = NAD(P)(+) + reduced acceptor. This enzyme is also involved in the bioactivation of prodrugs used in chemotherapy [(PUBMED:2168383)]. This domain is also found in acyl carrier protein phosphodiesterase EC 3.1.4.14. This enzyme converts holo-ACP to apo-ACP by hydrolytic cleavage of the phosphopantetheine residue from ACP [(PUBMED:7568029)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Flavodoxin_2