The domain within your query sequence starts at position 4 and ends at position 212; the E-value for the Flavodoxin_2 domain shown below is 9.7e-52.
RRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGELKDS KNFQYPSESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERVLVA GFAYTYAAMYDNGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFCGFQ VLEPQLVYSIGHTPPDARMQILEGWKKRL
Flavodoxin_2 |
---|
PFAM accession number: | PF02525 |
---|---|
Interpro abstract (IPR003680): | This entry represents a domain with a flavodoxin-like fold. Proteins with this domain include bacterial and eukaryotic NAD(P)H dehydrogenase (quinone) EC 1.6.99.2 . These enzymes catalyse the NAD(P)H-dependent two-electron reductions of quinones and protect cells against damage by free radicals and reactive oxygen species [ (PUBMED:2168383) ]. This enzyme uses a FAD cofactor. The equation for this reaction is NAD(P)H + acceptor = NAD(P)(+) + reduced acceptor. This enzyme is also involved in the bioactivation of prodrugs used in chemotherapy [ (PUBMED:2168383) ]. This domain is also found in acyl carrier protein phosphodiesterase EC 3.1.4.14 . This enzyme converts holo-ACP to apo-ACP by hydrolytic cleavage of the phosphopantetheine residue from ACP [ (PUBMED:7568029) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Flavodoxin_2