The domain within your query sequence starts at position 5 and ends at position 126; the E-value for the Flavodoxin_5 domain shown below is 2.7e-9.

LLLYATQRGQAKAIAEEISEQAVSHGFSADLHCISESEKYDLKTETGPLVMVVSTTGTGD
PPDTARKFVKEIHNKTLPTDYFAHLQYGLLGLGDSEYTYFCNGGKVIDKRLQELGAQRFY
DT

Flavodoxin_5

Flavodoxin_5
PFAM accession number:PF12724
Interpro abstract (IPR026816): This entry represents the flavodoxin domain. Proteins with this domain include protoporphyrinogen IX dehydrogenase (HemG). HemG catalyses the 6-electron oxidation of protoporphyrinogen-IX to form protoporphyrin-IX using menaquinone as electron acceptor [(PUBMED:7788523), (PUBMED:7916647)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Flavodoxin_5