The domain within your query sequence starts at position 311 and ends at position 422; the E-value for the Flot domain shown below is 5.1e-12.

LAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALVLEALPQIAAK
ISAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLIKN

Flot

Flot
PFAM accession number:PF15975
Interpro abstract (IPR031905):

Flotillin is a family of lipid-membrane-associated proteins found in bacteria, archaea and eukaryotes. Flotillins in vertebrates are associated with sphingolipids and cholesterol-enriched membrane microdomains, known as lipid-rafts [(PUBMED:22329548)]. These rafts, along with other membrane components, are important in cell-signalling. Flotillins in other organisms have roles in viral pathogenesis, endocytosis, and membrane shaping [(PUBMED:20018678), (PUBMED:22215737), (PUBMED:22882210)].

This entry represents the C-terminal domain of flotilin-1 and flotilin-2.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Flot