The domain within your query sequence starts at position 30 and ends at position 161; the E-value for the Flt3_lig domain shown below is 2.5e-63.

DCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKT
VAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKA
CQNFSRCLEGLI

Flt3_lig

 Flt3_lig
PFAM accession number:PF02947
Interpro abstract (IPR004213):

The flt3 (fms-related tyrosine kinase 3) ligand is a short chain cytokine with a 4 helical bundle fold. It is a type I membrane protein which stimulates the proliferation of of early hematopoeitic cells, and synergises well with other colony stimulating factors and interleukins.

GO component:membrane (GO:0016020)
GO function:cytokine activity (GO:0005125)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Flt3_lig