The domain within your query sequence starts at position 30 and ends at position 162; the E-value for the Flt3_lig domain shown below is 3.8e-65.
DCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKT VAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKA CQNFSRCLEVQCQ
Flt3_lig |
---|
PFAM accession number: | PF02947 |
---|---|
Interpro abstract (IPR004213): | The flt3 (fms-related tyrosine kinase 3) ligand is a short chain cytokine with a 4 helical bundle fold. It is a type I membrane protein which stimulates the proliferation of of early hematopoeitic cells, and synergises well with other colony stimulating factors and interleukins. |
GO component: | membrane (GO:0016020) |
GO function: | cytokine activity (GO:0005125) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Flt3_lig