The domain within your query sequence starts at position 26 and ends at position 475; the E-value for the Fmp27 domain shown below is 1.6e-45.

VVRLATRWCQRKLQAELKIGSFRFFWIQNVSLKFQQHQQTVEIDNLWISSKLLSHDLPNY
VALCFGEVRIRTDLQKVSSLSAPFSQNTEVEQKELSLSPSLLKIFCQLFSIHVDAINIMV
LKVATSESLWHIQISRSRFLLDSDGKSLICKVNLSKINSKVLKSGQLEDTCLVELSLALD
LRLQVSVSSWHLTAVTVDVWTLHAELHEGLFHSQLLCHAPGRISKSVSCSDLTENFAEPT
LPGLYLLQRLPDQVKVKMENTSVVLSMNSQKRHLTWTLKLLHFLYHRDEDQLPLRSFTAN
YDMAQMSTELLLEDGLLLSQSRQRIVCLNSLKANVQVTTIDLSASLVLNTCIIHYRHQEF
SHWLLMLALETQGASSPDLKQRKKRTFPQILAPIIFSTSVSNVSISIQLGDTPPFALGFN
SISLDYQHLRPQSIHQRAVLTVDHLCWRVG

Fmp27

Fmp27
PFAM accession number:PF10344
Interpro abstract (IPR019439):

The function of the FMP27 protein is not known. FMP27 is the product of a nuclear encoded gene but it is detected in highly purified mitochondria in high-throughput studies [(PUBMED:16823961)].

This entry represents a conserved region in FMP27 that contains a characteristic FAQPTW sequence motif.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fmp27