The domain within your query sequence starts at position 446 and ends at position 674; the E-value for the Fmp27 domain shown below is 3.2e-24.
SISLDYQHLRPQSIHQRAVLTVDHLCWRVGSDSHIQRAPHPPNMHVWGEALVLDSFTLQG SYNQPLGLSSTQSNTLFLDCTIRGLQVEISDICAQCLSRVLSLVIPQSERSAVSRKSSLG ESVTLLWKVDLKVEDMNLFTLSALVGASELRLDTLTVLGSAETSTVGIQGLVLALVKSVT EKMQPCCKAPDIPTPVLGLSMLSLTYHSSIRSLEVQCGAGLTLLWSPPD
Fmp27 |
---|
PFAM accession number: | PF10344 |
---|---|
Interpro abstract (IPR019439): | The function of the FMP27 protein is not known. FMP27 is the product of a nuclear encoded gene but it is detected in highly purified mitochondria in high-throughput studies [ (PUBMED:16823961) ]. This entry represents a conserved region in FMP27 that contains a characteristic FAQPTW sequence motif. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fmp27