SMART: Pfam domain Fn3

The domain within your query sequence starts at position 32 and ends at position 100; the E-value for the Fn3_assoc domain shown below is 1.6e-17.

LEMKSDTPDVNIYYTLDGSKPDFLKKVGSGENNTFKYVKPITLPDGKIQVKAVAVSKDCR
QSGIVTKVF

Fn3_assoc

PFAM accession number:	PF13287
Interpro abstract (IPR026876):	The entry represents a Fn3 (fibronectin type III) associated repeat. This repeat is found in several glycosyl hydrolase families of proteins such as a glycoside hydrolase T2KM09 that may be involved in ulvan degradation [ (PUBMED:31285597) ] or endoglucanase, which is responsible for the endohydrolysis of (1->4)-beta-D-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans [ (PUBMED:3389820) ].

PFAM accession number:

PF13287

Interpro abstract (IPR026876):

The entry represents a Fn3 (fibronectin type III) associated repeat. This repeat is found in several glycosyl hydrolase families of proteins such as a glycoside hydrolase T2KM09 that may be involved in ulvan degradation [ (PUBMED:31285597) ] or endoglucanase, which is responsible for the endohydrolysis of (1->4)-beta-D-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans [ (PUBMED:3389820) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fn3_assoc