The domain within your query sequence starts at position 32 and ends at position 100; the E-value for the Fn3_assoc domain shown below is 1.6e-17.

LEMKSDTPDVNIYYTLDGSKPDFLKKVGSGENNTFKYVKPITLPDGKIQVKAVAVSKDCR
QSGIVTKVF

Fn3_assoc

 Fn3_assoc
PFAM accession number:PF13287
Interpro abstract (IPR026876): The entry represents a Fn3 (fibronectin type III) associated repeat. Proteins with this repeat include endoglucanase, which is responsible for the endohydrolysis of (1->4)-beta-D-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans [(PUBMED:3389820)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fn3_assoc