The domain within your query sequence starts at position 1 and ends at position 112; the E-value for the Folate_carrier domain shown below is 1.3e-45.

XSFSAGFLSIRWTLWSKLVIAGVIAIQASLVFCMFQIRDIWVCYVTFVLFRGAYQFLVPI
ATFQIASSLSKELCALVFGINTFLATALKTCITLVVSDKRGLGLQVRDQNCI

Folate_carrier

Folate_carrier
PFAM accession number:PF01770
Interpro abstract (IPR002666):

This entry represents the reduced folate carrier family, including folate transporter 1 (SLC19A1), thiamine transporter 1 (SLC19A2) and thiamine transporter 2 (SLC19A3). Despite their protein sequence/structure similarity, they have different functions.

The transporter 1 (SLC19A1, also known as the reduced folate carrier protein, RFC) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [(PUBMED:9161403)], such as methotrexate (MTX). Mammalian cells have an absolute requirement for exogenous folates which are needed for growth, and biosynthesis of macromolecules [(PUBMED:9161403)].

Thiamine transporter 1 (SLC19A2) and thiamine transporter 2 (SLC19A3) are high-affinity transporters for the intake of thiamine [(PUBMED:11731220)]. They do not transport reduced or oxidized folates.

GO process:vitamin transport (GO:0051180)
GO component:integral component of membrane (GO:0016021)
GO function:vitamin transmembrane transporter activity (GO:0090482)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Folate_carrier