The domain within your query sequence starts at position 27 and ends at position 203; the E-value for the Folate_rec domain shown below is 2e-40.

ACGWSHPLQTRSWGHPGLAAKVRTGQLQPAGHPQSSVLPSYPRIQVPGSQTPPVPVPCCT
AEIDRPESLLESCGAPSPECEFFLGQLQGALRDRFHPQLFGARPVQPLCPELCQIWFTTC
QADFICGPTWLQSSGERGCEPSCRTYGQTFANATDLCHSVLGHVLRVAAPGSSHCLN

Folate_rec

Folate_rec
PFAM accession number:PF03024
Interpro abstract (IPR018143): This entry represents a domain found in folate receptors and at the N terminus of hedgehog-interacting proteins. Folate receptors bind to folate and reduced folic acid derivatives and mediate delivery of 5-methyltetrahydrofolate to the interior of cells. These proteins are attached to the membrane by a GPI-anchor. A riboflavin-binding protein required for the transport of riboflavin to the developing oocyte in chicken also included in this entry.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Folate_rec