The domain within your query sequence starts at position 78 and ends at position 262; the E-value for the Folliculin domain shown below is 5e-12.

DTKVFGTFDLNYFSLRIMSVDYQASFVGHPPGSAYPKLNFVEDSKVVLGDSKEGAFAYVH
HLTLYDLEARGFVRPFCMAYISADQHKIMQQFQELSAEFSKASECLKMGNRKAFAGELEK
KLKDLDYTRTVLHTETEIQKKANDKGFYSSQAIEKANELANVEKSIIEHQDLLRQIRSYP
RQKTK

Folliculin

Folliculin
PFAM accession number:PF11704
Interpro abstract (IPR037520):

This is the N-terminal domain of folliculin. This domain shares structural similarity with DENN domain of DENN1B (a Rab GEF), and has guanine nucleotide exchange factor (GEF) activity [(PUBMED:22977732)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Folliculin