The domain within your query sequence starts at position 204 and ends at position 310; the E-value for the Formyl_trans_C domain shown below is 4e-18.

QKKETAMINWDQPAEAIHNWIRGNDKVPGAWTEACGQKLTFFNSTLNTSGLVAQGEALPI
PGAHRPGLVTKAGLILFGNDDRMLLVKNIQLEDGKMMPASQFFKGSA

Formyl_trans_C

Formyl_trans_C
PFAM accession number:PF02911
Interpro abstract (IPR005793):

Methionyl-tRNA formyltransferase (EC 2.1.2.9) transfers a formyl group onto the amino terminus of the acyl moiety of the methionyl aminoacyl-tRNA. The formyl group appears to play a dual role in the initiator identity of N-formylmethionyl-tRNA by promoting its recognition by IF2 and by impairing its binding to EFTU-GTP. This family also includes formyltetrahydrofolate dehydrogenases, which produce formate from formyl-tetrahydrofolate. These enzymes contain an N-terminal domain in common with other formyl transferase enzymes (IPR002376). The C-terminal domain has an open beta-barrel fold [(PUBMED:8887566)].

GO process:biosynthetic process (GO:0009058)
GO function:hydroxymethyl-, formyl- and related transferase activity (GO:0016742)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Formyl_trans_C