The domain within your query sequence starts at position 208 and ends at position 269; the E-value for the Fox-1_C domain shown below is 1e-22.

VTSFPYPTTGTAVAYRGAHLRGRGRAVYNTFRAAPPPPPIPTYGAALEQTLVKMPVPWAG
LA

Fox-1_C

Fox-1_C
PFAM accession number:PF12414
Interpro abstract (IPR025670):

This domain is found in the C-terminal section of Fox-1 and its homologues, which regulate alternative splicing events by binding to 5'-UGCAUGU-3' elements [(PUBMED:16537540), (PUBMED:15824060)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fox-1_C