The domain within your query sequence starts at position 319 and ends at position 374; the E-value for the Fox-1_C domain shown below is 2.9e-18.
IIPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPGVDMQPTDMHS
Fox-1_C |
---|
PFAM accession number: | PF12414 |
---|---|
Interpro abstract (IPR025670): | This domain is found in the C-terminal section of Fox-1 and its homologues, which regulate alternative splicing events by binding to 5'-UGCAUGU-3' elements [ (PUBMED:16537540) (PUBMED:15824060) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fox-1_C