The domain within your query sequence starts at position 104 and ends at position 220; the E-value for the Fra10Ac1 domain shown below is 7e-56.
TDLDVIRENHRFLWNEEDEADMTWEKRLAKKYYDKLFKEYCIADLSRYKENKFGFRWRIE KEVISGKGQFFCGNKCCNEKEGLRSWEVNFGYTEHGEKRNALVKLRLCQECSFKLNF
Fra10Ac1 |
---|
PFAM accession number: | PF09725 |
---|---|
Interpro abstract (IPR019129): | This entry represents the full-length proteins in which, in higher eukaryotes, the nested domain EDSLL lies. Fra10Ac1 is a highly conserved nuclear protein of unknown function that is highly expressed in brain tissue [ (PUBMED:15203205) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fra10Ac1