The domain within your query sequence starts at position 58 and ends at position 230; the E-value for the FragX_IP domain shown below is 4e-66.

ELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEK
FAFVEVIAMIKGLQVLMGRMESVFNQAIRNTIYAALQDFAQVTLREPLRQAVRKKKNVLI
SVLQAIRKTICDWEGGREPPNDPCLRGEKDPKGGFDIKVPRRAVGPSSTQACQ

FragX_IP

FragX_IP
PFAM accession number:PF05994
Interpro abstract (IPR008081):

This entry includes cytoplasmic fragile X mental retardation protein interacting proteins from humans and their homologues, such as Sra-1 (specifically Rac1-associated protein 1) from Drosophila and PIROGI from Arabidopsis.

In humans, there are two members, CYFIP1 and CYFIP2. They both interact with FMRP (fragile X mental retardation protein), which is responsible for pathologic manifestations in the Fragile X Syndrome. CYFIP1 interacts with the small GTPase Rac1 [ (PUBMED:26824476) (PUBMED:11438699) ]. CYFIP1 represses cap-dependent translation of mRNA by interacting with the initiation factor eIF4E [ (PUBMED:18805096) ]. CYFIP1 and CYFIP2 are part of the Wiskott-Aldrich syndrome protein-family verprolin-homologous protein (WAVE) complex that regulates actin polymerization at synapses [ (PUBMED:27524794) ].

Drosophila Sra-1 interacts with the Kette and Wasp. It is required for neuronal and bristle development in Drosophila [ (PUBMED:15269173) ].

PIROGI is part of a WAVE complex that activates the ARP2/3 complex and is Involved in regulation of actin organization [ (PUBMED:15294869) ].

GO process:regulation of actin filament polymerization (GO:0030833)
GO function:Rac GTPase binding (GO:0048365)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FragX_IP