The domain within your query sequence starts at position 58 and ends at position 230; the E-value for the FragX_IP domain shown below is 4e-66.
ELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTDKFCNKDCPGTAEEYERATRYNYTSEEK FAFVEVIAMIKGLQVLMGRMESVFNQAIRNTIYAALQDFAQVTLREPLRQAVRKKKNVLI SVLQAIRKTICDWEGGREPPNDPCLRGEKDPKGGFDIKVPRRAVGPSSTQACQ
FragX_IP |
---|
PFAM accession number: | PF05994 |
---|---|
Interpro abstract (IPR008081): | This entry includes cytoplasmic fragile X mental retardation protein interacting proteins from humans and their homologues, such as Sra-1 (specifically Rac1-associated protein 1) from Drosophila and PIROGI from Arabidopsis. In humans, there are two members, CYFIP1 and CYFIP2. They both interact with FMRP (fragile X mental retardation protein), which is responsible for pathologic manifestations in the Fragile X Syndrome. CYFIP1 interacts with the small GTPase Rac1 [ (PUBMED:26824476) (PUBMED:11438699) ]. CYFIP1 represses cap-dependent translation of mRNA by interacting with the initiation factor eIF4E [ (PUBMED:18805096) ]. CYFIP1 and CYFIP2 are part of the Wiskott-Aldrich syndrome protein-family verprolin-homologous protein (WAVE) complex that regulates actin polymerization at synapses [ (PUBMED:27524794) ]. Drosophila Sra-1 interacts with the Kette and Wasp. It is required for neuronal and bristle development in Drosophila [ (PUBMED:15269173) ]. PIROGI is part of a WAVE complex that activates the ARP2/3 complex and is Involved in regulation of actin organization [ (PUBMED:15294869) ]. |
GO process: | regulation of actin filament polymerization (GO:0030833) |
GO function: | Rac GTPase binding (GO:0048365) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FragX_IP