The domain within your query sequence starts at position 14 and ends at position 250; the E-value for the Frizzled domain shown below is 2e-8.

ERAVVLLSCALSALGSGLLVATHALWPDLRSRARRLLLFLSLADLLSAASYFYGVLQDFA
GTSWDCVLQGALSTFANTSSFFWTVAIALYLYLSIVRTTRGPSTDHLIWAFHLISWGVPL
AITVAAVSLKKIGYDASDVSVGWCWINLEAEDRVLWMLLTGKLWEMLAYILLPLLYLLVR
KHINRAHQALSEYRPICEGRQLQRGSSTSTADKKLVLIPLIFICLRVWSTVRFVLTL

Frizzled

 Frizzled
PFAM accession number:PF01534
Interpro abstract (IPR000539):

This domain is the membrane spanning region of frizzled and smoothened receptors. This membrane region is predicted to contain seven transmembrane alpha helices. Proteins related to Drosophila frizzled ( P18537 ) are receptors for Wnt (mediating the beta-catenin signalling pathway) [ (PUBMED:8717036) ], but also the planar cell polarity (PCP) pathway and the Wnt/calcium pathway. The predominantly alpha-helical Cys-rich ligand-binding region (CRD) of Frizzled is both necessary and sufficient for Wnt binding [ (PUBMED:15239825) ]. The smoothened receptor mediates hedgehog signalling [ (PUBMED:9811578) ].

GO process:cell surface receptor signaling pathway (GO:0007166)
GO component:membrane (GO:0016020)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Frizzled