The domain within your query sequence starts at position 35 and ends at position 77; the E-value for the FtsK_SpoIIIE domain shown below is 4.3e-8.
ENKLQKAVSVIEKVLRDIESAPLHIAVTGETGAGKSTFINTLR
FtsK_SpoIIIE |
---|
PFAM accession number: | PF01580 |
---|---|
Interpro abstract (IPR002543): | The FtsK domain is a hydrophilic domain of about 200 residues, which is found in:
The FtsK domain contains a highly conserved putative ATP-binding P-loop motif and is assumed to be cytoplasmic. It can be found in one to three copies and is thought to be involved in DNA translocation by coupling ATP hydrolysis to movement relative to the long axis of DNA [ (PUBMED:7592387) (PUBMED:11433368) (PUBMED:11973144) ]. |
GO function: | ATP binding (GO:0005524), nucleotide binding (GO:0000166), DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FtsK_SpoIIIE