The domain within your query sequence starts at position 452 and ends at position 505; the E-value for the FumaraseC_C domain shown below is 2.5e-29.

LVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLG

FumaraseC_C

FumaraseC_C
PFAM accession number:PF10415
Interpro abstract (IPR018951):

Fumarase C catalyses the stereo-specific interconversion of fumarate to L-malate as part of the Krebs cycle. The full-length protein forms a tetramer with visible globular shape. FumaraseC_C is the C-terminal 65 residues referred to as domain 3. The core of the molecule consists of a bundle of 20 alpha-helices from the five-helix bundle of domain 2. The projections from the core of the tetramer are generated from domains 1 and 3 of each subunit [(PUBMED:8909293)]. This entry does not appear to be part of either the active site or the activation site but is helical in structure forming a little bundle.

GO process:tricarboxylic acid cycle (GO:0006099)
GO function:lyase activity (GO:0016829)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry FumaraseC_C