The domain within your query sequence starts at position 452 and ends at position 505; the E-value for the FumaraseC_C domain shown below is 2.5e-29.
LVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPKDMLG
FumaraseC_C |
 |
|---|
| PFAM accession number: | PF10415 |
|---|---|
| Interpro abstract (IPR018951): | Fumarase C catalyses the stereo-specific interconversion of fumarate to L-malate as part of the Krebs cycle. The full-length protein forms a tetramer with visible globular shape. FumaraseC_C is the C-terminal 65 residues referred to as domain 3. The core of the molecule consists of a bundle of 20 alpha-helices from the five-helix bundle of domain 2. The projections from the core of the tetramer are generated from domains 1 and 3 of each subunit [ (PUBMED:8909293) ]. This entry does not appear to be part of either the active site or the activation site but is helical in structure forming a little bundle. |
| GO process: | tricarboxylic acid cycle (GO:0006099) |
| GO function: | lyase activity (GO:0016829) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry FumaraseC_C