The domain within your query sequence starts at position 471 and ends at position 577; the E-value for the Fz domain shown below is 3e-25.

CEPVQVEMCLGLSYNTTAFPNIWVGLATQTEVTDILRGYKSLTSLPCYQTFQRFLCGLLV
PRCTSLGTILPPCRSVCQAAEQQCQSSLALLGTPWPFNCNRLPVAAS

Fz

Fz
PFAM accession number:PF01392
Interpro abstract (IPR020067):

The frizzled (fz) domain is an extracellular domain of about 120 amino acids.It was first identified in the alpha-1 chain of type XVIII collagen and in members of the Frizzled family of seven transmembrane (7TM) proteins which act as receptors for secreted Wingless (Wg)/Wnt glycoproteins [(PUBMED:7876242)]. In addition to these proteins, one or two copies of the fz domain are also found [(PUBMED:9637908), (PUBMED:9637909), (PUBMED:10082384), (PUBMED:9852758), (PUBMED:10329693)] in:

  • The Frzb family; secreted frizzled-like proteins.
  • Smoothened; another 7TM receptor involved in hedgehog signaling.
  • Carboxpeptidase Z (CPZ).
  • Transmembrane serine protease corin (atrial natriuretic peptide-converting enzyme).
  • Two receptor tyrosine kinases (RTKs) subfamilies, the Ror family and the muscle-specific kinase (MuSK) family.

As the fz domain contains 10 cysteines which are largely conserved, it has also been called cysteine-rich domain (CRD) [(PUBMED:7876242)]. The fz domain also contains several other highly conserved residues, for example, a basic amino acid follows C6, and a conserved proline residues lies four residues C-terminal to C9 [(PUBMED:9852758)]. The crystal structure of a fz domain shows that it is predominantly alpha-helical with all cysteines forming disulphide bonds. In addition to helical regions, two short beta-strands at the N terminus form a minimal beta-sheet with the second beta sheet passing through a knot created by disulphide bonds [(PUBMED:11452312)].

Several fz domains have been shown to be both necessary and sufficient for Wg/Wnt ligand binding, strongly suggesting that the fz domain is a Wg/Wnt interacting domain [(PUBMED:8717036), (PUBMED:9326585)].

GO function:protein binding (GO:0005515)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fz