The domain within your query sequence starts at position 567 and ends at position 737; the E-value for the Fzo_mitofusin domain shown below is 6.3e-86.

SNPAAPDNAAQEELMITLITGLASLTSRTSMGIIVVGGVIWKTVGWKLISVTLSMYGALY
LYERLTWTTRAKERAFKQQFVNYATEKLQMIVSFTSANCSHQVQQEMATTFARLCQQVDV
TQKHLEEEIARLSKEIDQLEKIQNNSKLLRNKAVQLESELENFSKQFLHPS

Fzo_mitofusin

Fzo_mitofusin
PFAM accession number:PF04799
Interpro abstract (IPR006884):

This entry represents the heptad repeat domain which is conserved at the C terminus of Fzo/mitofusion family of GTPases. Fzo is a mediator of mitochondrial fusion during spermatogenesis [(PUBMED:9230308)]. This conserved region is also found in the human mitofusin protein [(PUBMED:11181170)].

This domain forms a dimeric antiparallel coiled coil structure, which has been proposed to act as a mitochodrial tether before vesicle fusion [(PUBMED:15297672)].

GO process:mitochondrial fusion (GO:0008053)
GO component:mitochondrial outer membrane (GO:0005741), integral component of membrane (GO:0016021)
GO function:GTPase activity (GO:0003924)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fzo_mitofusin