The domain within your query sequence starts at position 586 and ends at position 756; the E-value for the Fzo_mitofusin domain shown below is 3.9e-86.

MPPLPQSSLTQEELMVSMVTGLASLTSRTSMGILVVGGVVWKAVGWRLIALSFGLYGLLY
VYERLTWTTKAKERAFKRQFVEYASEKLQLIISYTGSNCSHQVQQELSGTFAHLCQQVDI
TRDNLEQEIAAMNKKVEALDSLQSRAKLLRNKAGWLDSELNMFTHQYLQPS

Fzo_mitofusin

Fzo_mitofusin
PFAM accession number:PF04799
Interpro abstract (IPR006884):

This entry represents the heptad repeat domain which is conserved at the C terminus of Fzo/mitofusion family of GTPases. Fzo is a mediator of mitochondrial fusion during spermatogenesis [ (PUBMED:9230308) ]. This conserved region is also found in the human mitofusin protein [ (PUBMED:11181170) ].

This domain forms a dimeric antiparallel coiled coil structure, which has been proposed to act as a mitochodrial tether before vesicle fusion [ (PUBMED:15297672) ].

GO process:mitochondrial fusion (GO:0008053)
GO component:mitochondrial outer membrane (GO:0005741), integral component of membrane (GO:0016021)
GO function:GTPase activity (GO:0003924)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Fzo_mitofusin