The domain within your query sequence starts at position 1 and ends at position 103; the E-value for the G0-G1_switch_2 domain shown below is 1.8e-46.
MESVQELIPLAKEMMAQKPRGKLVKLYVLGSVLALFGVVLGLVETVCSPFTAASRLRDQE AAVVELREACEQQSLHKQALLAGGKAQEATLCSRALSLRQHAS
G0-G1_switch_2 |
 |
|---|
| PFAM accession number: | PF15103 |
|---|---|
| Interpro abstract (IPR016821): | This group represents the G0/G1 switch protein 2 (G0S2) [ (PUBMED:1930693) ]. In humans, it promotes apoptosis by binding to BCL2, hence preventing the formation of protective BCL2-BAX heterodimers [ (PUBMED:19706769) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry G0-G1_switch_2