The domain within your query sequence starts at position 1 and ends at position 144; the E-value for the G10 domain shown below is 2.2e-69.
MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYI FDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICR VPKSKLEVGRIIECTHCGCRGCSG
G10 |
---|
PFAM accession number: | PF01125 |
---|---|
Interpro abstract (IPR001748): | A Xenopus protein known as G10 [ (PUBMED:2568313) ] has been found to be highly conserved in a wide range of eukaryotic species. The function of G10 is still unknown. G10 is a protein of about 17 to 18kDa (143 to 157 residues) which is hydrophilic and whose C-terminal half is rich in cysteines and could be involved in metal-binding. |
GO component: | nucleus (GO:0005634) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry G10