The domain within your query sequence starts at position 212 and ends at position 387; the E-value for the G6PD_C domain shown below is 3.6e-42.
LPFRDQNRKALDGLWNRHHVERVEIILKETIDAEGRASFYEEYGVIRDTLQNHLTEILTL VAMELPLNISSSAAVLQHKLWAFQALRGLQKSSAILGQYQAYSGQVRRELQKPDGFQSLT PTFAGVLVHIDNLRWEGVPFILMSGKALDERVGYVRIVFKNRAYCTQSERHWVPEQ
G6PD_C |
---|
PFAM accession number: | PF02781 |
---|---|
Interpro abstract (IPR022675): | Glucose-6-phosphate dehydrogenase ( EC 1.1.1.49 ) (G6PDH) is a ubiquitous protein, present in bacteria and all eukaryotic cell types [ (PUBMED:2838391) ]. The enzyme catalyses the the first step in the pentose pathway, i.e. the conversion of glucose-6-phosphate to gluconolactone 6-phosphate in the presence of NADP, producing NADPH. The ubiquitous expression of the enzyme gives it a major role in the production of NADPH for the many NADPH-mediated reductive processes in all cells [ (PUBMED:3393536) ]. Deficiency of G6PDH is a common genetic abnormality affecting millions of people worldwide. Many sequence variants, most caused by single point mutations, are known, exhibiting a wide variety of phenotypes [ (PUBMED:3393536) ]. This entry represents the C-terminal domain of glucose-6-phosphate dehydrogenase. |
GO process: | oxidation-reduction process (GO:0055114), glucose metabolic process (GO:0006006) |
GO function: | NADP binding (GO:0050661), glucose-6-phosphate dehydrogenase activity (GO:0004345) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry G6PD_C