The domain within your query sequence starts at position 355 and ends at position 451; the E-value for the GAD domain shown below is 2e-13.

LQDALAKPQGTVKAICVHDGAKYLRKEDIEFIRKFAVHHFSQEVLPIFLNAKKNWSSPFA
KFIMEEERLELARSMEIQEEDIVLLTAGEHEKACSLL

GAD

GAD
PFAM accession number:PF02938
Interpro abstract (IPR029351):

This domain is found in the glutamyl-tRNA amidotransferase subunit E and some aspartyl tRNA ligases [(PUBMED:16809540), (PUBMED:11566892)]. The function of this domain is not yet known.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GAD