The domain within your query sequence starts at position 221 and ends at position 420; the E-value for the GAS domain shown below is 1.5e-82.

TLMQRHEEAFTDIKNYYNDITLNNLALINSLKEQMEDMRKKEEHMEREMAEVTLQNRRLA
DPLQKAKDEMNEMQKRLGNHERDKQILVCTKARLKVAERELKDLKWEHEVLEQRFIKVQQ
EREELYRKFADAIQEVQQKTGFKNLLLERKLQALNAAVEKREVQFNEVLAASNLDPTALT
LVSRKLEDVLESKNTTIKDL

GAS

GAS
PFAM accession number:PF13851
Interpro abstract (IPR025593):

This is the highly conserved central region of Gas8 proteins. Growth arrest-specific protein 8 (Gas8) is a microtubule-binding protein localised to regions of dynein regulation in mammalian cells. In mouse, Gas8 is predominantly a testicular protein, whose expression is developmentally regulated during puberty and spermatogenesis. In humans, it is absent in infertile males who lack the ability to generate gametes. The localisation of Gas8 in the motility apparatus of post-meiotic gametocytes and mature spermatozoa, together with the detection of Gas8 also in cilia at the apical surfaces of epithelial cells lining the pulmonary bronchi and Fallopian tubes suggests that the Gas8 protein may have a role in the functioning of motile cellular appendages [(PUBMED:11751847)].

GO process:cell motility (GO:0048870)
GO component:motile cilium (GO:0031514)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GAS