The domain within your query sequence starts at position 215 and ends at position 284; the E-value for the GAS2 domain shown below is 1.8e-29.

LHEAVKHIAEDPPCSCSHRFSIEYLSEGRYRLGEKILFIRMLHGKHVMVRVGGGWDTLQG
FLLKYDPCRI

GAS2

GAS2
PFAM accession number:PF02187
Interpro abstract (IPR003108):

The GAR (Gas2-related) domain is common in plakin family members and Gas2 family members. It comprises around 57 amino acids and has been shown to bind to microtubules [(PUBMED:20335501), (PUBMED:11112700), (PUBMED:11854008)].

GO function:microtubule binding (GO:0008017)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GAS2