The domain within your query sequence starts at position 63 and ends at position 191; the E-value for the GATase_4 domain shown below is 3.2e-10.

KGKVKALDEEVHKQQDMDLDIEFDVHLGIAHTRWATHGEPNPVNSHPQRSDKNNEFIVIH
NGIITNYKDLKKFLESKGYDFESETDTETIAKLVKYMYDNWESQDVSFTTLVERVIQQLE
GAFALVFKS

GATase_4

GATase_4
PFAM accession number:PF13230
Interpro abstract (IPR026869): Proteins in this family contain a glutamine amidotransferase type-2 domain. One of the members, DUG3, is a component of the GSH degradosomal complex involved in the degradation of glutathione (GSH) and other peptides containing a gamma-glu-X bond [(PUBMED:17179087)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GATase_4