The domain within your query sequence starts at position 64 and ends at position 287; the E-value for the GCD14 domain shown below is 3.2e-113.

GWVYVLHPTPELWTVNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIR
SVAPTGHLHTVEFHQQRADKAREEFQEHRLSQWVTVHTQDVCCSGFGVVHVADAVFLDIP
SPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAAHGFTELSTLEVLPQVYNVRTV
SLPLPDLGANNLETNMGSDASPFRSGTPMKETVGHTGYLTFATK

GCD14

GCD14
PFAM accession number:PF08704
Interpro abstract (IPR014816):

Gcd14, also known as Trm61, is the catalytic subunit of tRNA (adenine-N(1)-)-methyltransferase [(PUBMED:14739239), (PUBMED:10779558)], which is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [(PUBMED:9851972)].

GO process:tRNA methylation (GO:0030488)
GO component:tRNA (m1A) methyltransferase complex (GO:0031515)
GO function:tRNA (adenine-N1-)-methyltransferase activity (GO:0016429)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GCD14