The domain within your query sequence starts at position 597 and ends at position 812; the E-value for the GCFC domain shown below is 5.1e-39.
IDCIKAQFEAWRSKYYMSYKDAYIGLCLPKLFNPLIRLQLLTWTPLEAKCRDFETMLWFE SLLFYGCEDREQEKDEADVALLPTIVEKVILPKLTVIAETMWDPFSTTQTSRMVGITMKL INGYPSVVNADNKNTQVYLKALLLRMRRTLDDDVFMPLYPKNVLENKNSGPYLFFQRQFW SSVKLLGNFLQWYGIFSNKTLQELSIDGLLNRYILM
GCFC |
---|
PFAM accession number: | PF07842 |
---|---|
Interpro abstract (IPR022783): | This entry describes a domain found in a number of GC-rich sequence DNA-binding factor proteins and homologues [ (PUBMED:24304693) (PUBMED:22862948) ], as well as in a number of other proteins including Tuftelin-interacting protein 11 [ (PUBMED:19103666) ]. While the function of the domain is unknown, some of the proteins it is found in are reported to be involved in pre-mRNA splicing [ (PUBMED:19103666) (PUBMED:25568310) ]. This domain is also found in Sip1, a septin interacting protein [ (PUBMED:11884525) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GCFC