The domain within your query sequence starts at position 30 and ends at position 167; the E-value for the GCM domain shown below is 4.2e-75.

TDWFQEWPDSYVKHIYSSDDRNAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCSRDCSTE
EGRKIYLRPAICDKARQKQQRKSCPNCNGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSK
GEHDHPRPETKLEAEARR

GCM

GCM
PFAM accession number:PF03615
Interpro abstract (IPR003902):

GCM transcription factors are a family of proteins which contain a GCM motif. The GCM motif is a domain that has been identified in proteins belonging to a family of transcriptional regulators involved in fundamental developmental processes which comprise Drosophila melanogaster GCM and its mammalian homologues [(PUBMED:8962155), (PUBMED:9114061), (PUBMED:9580683), (PUBMED:10671510)]. IN GCM transcription factors the N-terminal moiety contains a DNA-binding domain of 150 residues. Sequence conservation is highest in this GCM domain. In contrast, the C-terminal moiety contains one or two transactivating regions and is only poorly conserved.

The GCM motif has been shown to be a DNA binding domain that recognises preferentially the nonpalindromic octamer 5'-ATGCGGGT-3' [(PUBMED:8962155), (PUBMED:9114061), (PUBMED:9580683)]. The GCM motif contains many conserved basic amino acid residues, seven cysteine residues, and four histidine residues [(PUBMED:8962155)]. The conserved cysteines are involved in shaping the overall conformation of the domain, in the process of DNA binding and in the redox regulation of DNA binding [(PUBMED:9580683)]. The GCM domain as a new class of Zn-containing DNA-binding domain with no similarity to any other DNA-binding domain [(PUBMED:12682016)]. The GCM domain consists of a large and a small domain tethered together by one of the two Zn ions present in the structure. The large and the small domains comprise five- and three-stranded beta-sheets, respectively, with three small helical segments packed against the same side of the two beta-sheets. The GCM domain exercises a novel mode of sequence-specific DNA recognition, where the five-stranded beta-pleated sheet inserts into the major groove of the DNA. Residues protruding from the edge strand of the beta-pleated sheet and the following loop and strand contact the bases and backbone of both DNA strands, providing specificity for its DNA target site.

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO function:DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GCM