The domain within your query sequence starts at position 5 and ends at position 125; the E-value for the GCN5L1 domain shown below is 3.1e-56.

LLKEHQAKQNERKELQEKRRREAIAAATCLTEALVDHLNVGVAQAYMNQRKLDHEVKTLQ
VQAAQFAKQTGQWIGMVENFNQALKEIGDVENWARSIELDMRTIATALEYVYKGQLQSAP
S

GCN5L1

GCN5L1
PFAM accession number:PF06320
Interpro abstract (IPR009395):

GCN5L1 (general control of amino acid synthesis 5-like 1), also known as BLOC1S1 (biogenesis of lysosome-related organelles complex 1 subunit 1). It is a component of the BLOC-1 complex, a complex required for normal biogenesis of lysosome-related organelles [(PUBMED:17182842)]. GCN5L1 has been identified as a critical component of the mitochondrial protein acetylation programme [(PUBMED:22309213), (PUBMED:25400169)]. It acts as a nutrient-sensing regulator that controls mitochondrial content through coordinated regulation of mitochondrial biogenesis and autophagy [(PUBMED:24356961)].

GO component:BLOC-1 complex (GO:0031083)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GCN5L1