The domain within your query sequence starts at position 236 and ends at position 608; the E-value for the GCS domain shown below is 1.3e-185.

IYMDAMGFGMGNCCLQVTFQACSISEARYLYDQLATICPIVMALSAASPFYRGYVSDIDC
RWGVISASVDDRTREERGLEPLKNNRFRISKSRYDSIDSYLSKCGEKYNDIDLTIDKEIY
EQLLEEGIDHLLAQHVAHLFIRDPLTLFEEKIHLDDANESDHFENIQSTNWQTMRFKPPP
PNSDIGWRVEFRPMEVQLTDFENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQK
RDAVLQGMFYFRKDICKGGNAVVDGCSKAQSSSEPAAEEYTLMSIDTIINGKEGVFPGLI
PILNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITD
EINYSLIWKCNQI

GCS

GCS
PFAM accession number:PF03074
Interpro abstract (IPR004308): This family represents the catalytic subunit of glutamate-cysteine ligase (EC 6.3.2.2), also known as gamma-glutamylcysteine synthetase (GCS). This enzyme catalyses the rate limiting step in the biosynthesis of glutathione. The eukaryotic enzyme is a dimer of a heavy chain and a light chain with all the catalytic activity exhibited by the heavy chain.
GO process:glutathione biosynthetic process (GO:0006750)
GO function:glutamate-cysteine ligase activity (GO:0004357)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GCS