The domain within your query sequence starts at position 48 and ends at position 168; the E-value for the GCV_H domain shown below is 1.2e-51.
RKFTEKHEWITTEEGIGTVGISNFAQEALGDVVYCSLPEVGTKLKKQEEFGALESVKAAS ELYSPLSGEVTEVNEALAENPGLVNKSCYEDGWLIKMTLSDPSEMDELMSEEAYEKYVKS I
GCV_H |
---|
PFAM accession number: | PF01597 |
---|---|
Interpro abstract (IPR033753): | This is a family of glycine cleavage H-proteins, part of the glycine cleavage system (GCS) found in bacteria, archaea, and the mitochondria of eukaryotes. GCS is a multienzyme complex consisting of 4 different components (P-, H-, T- and L-proteins) which catalyzes the oxidative cleavage of glycine [ (PUBMED:11286922) ]. The H-protein shuttles the methylamine group of glycine from the P-protein (glycine dehydrogenase) to the T-protein (aminomethyltransferase) via a lipoyl group, attached to a completely conserved lysine residue [ (PUBMED:8197146) ]. This enty includes Abitram proteins. Abitram (also known as Simiate) functions in transcription regulation [ (PUBMED:24349419) ]. Furthermore, it associates with both G- and F-Actin and affects actin polymerization and actin turnover, influencing filopodia dynamics and arborization of neurons [ (PUBMED:24782708) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GCV_H