The domain within your query sequence starts at position 745 and ends at position 838; the E-value for the GCV_T_C domain shown below is 3.9e-26.
ADFIGKQALKQIKTEGLKRRLVCLTVATDDVDPEGNESIWYKGKVVGNTTSGSYSYSIQK SLAFAYVPVQLSEVGQQVEVELLGKNYPATIIQE
GCV_T_C |
![]() |
---|
PFAM accession number: | PF08669 |
---|---|
Interpro abstract (IPR013977): | This entry represents the C-terminal beta-barrel domain of glycine cleavage T-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes [ (PUBMED:15609340) ]. GCV catalyses the catabolism of glycine in eukaryotes. The T-protein is an aminomethyl transferase. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GCV_T_C