The domain within your query sequence starts at position 807 and ends at position 904; the E-value for the GCV_T_C domain shown below is 4.7e-16.

PFLGREALEKQRATGLRRRLICLTVEEEVPMFGLEAIWRNGQVVGHVRRADFGFTVNKTI
AYGYIRDPSGGPVSLDFVKNGEYALERMGVTYAAQVHL

GCV_T_C

GCV_T_C
PFAM accession number:PF08669
Interpro abstract (IPR013977):

This entry represents the C-terminal beta-barrel domain of glycine cleavage T-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes [(PUBMED:15609340)]. GCV catalyses the catabolism of glycine in eukaryotes. The T-protein is an aminomethyl transferase.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GCV_T_C