The domain within your query sequence starts at position 40 and ends at position 281; the E-value for the GDA1_CD39 domain shown below is 6.1e-101.

NKPLPENVKYGIVLDAGSSHTNLYIYKWPAEKENDTGVVQQLEECQVKGPGISKYAQKTD
EIGAYLAECMELSTELIPTSKHHQTPVYLGATAGMRLLRMESEQSADEVLAAVSTSLKSY
PFDFQGAKIITGQEEGAYGWITINYLLGRFTQEQSWLSLISDSQKQETFGALDLGGASTQ
ITFVPQNSTIESPENSLQFRLYGEDYTVYTHSFLCYGKDQALWQKLAKDIQAISNPGHWR
LR

GDA1_CD39

GDA1_CD39
PFAM accession number:PF01150
Interpro abstract (IPR000407):

A number of nucleoside diphosphate and triphosphate hydrolases as well as some yet uncharacterised proteins have been found to belong to the same family [(PUBMED:8579614), (PUBMED:8703025)]. The uncharacterised proteins all seem to be membrane-bound.

GO function:hydrolase activity (GO:0016787)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GDA1_CD39