The domain within your query sequence starts at position 1061 and ends at position 1527; the E-value for the GDE_C domain shown below is 1.1e-137.

PSLLDVPCRLNEITKEKEQCCASLAAGLPHFSSGLFRCWGRDTFIALRGMLLVTGRYLEA
RNIILAFASTLRHGLIPNLLGEGTYARYNCRDAVWWWLQCIQDYCRTVPNGLDILKCPVS
RMYPTDDSAPLPAGTLDQPLFEVIQEAMQRHMQGIQFRERNAGPQIDRNMKDEGFNITAG
IDEETGFVYGGNRFNCGTWMDKMGESDRARNRGIPATPRDGSAVEIVGLCKSAVRWLLEL
SKKNIFPYHEVRVKRHGKVVAVSYDEWNRKIQNNFEKLFHVSEDPSDPNEKHPNLVHKRG
IYKDSYGASSPWCDYQLRPNFTIAMVVAPELFTAEKAWKALEIAEKKLLGPLGMKTLDPD
DMVYCGVYDNALDNDNYNLARGFNYHQGPEWLWPIGYFLRAKLYFSKMMGPETAAKTVFL
VKNVLSRHYVHLERSPWKGLPELTNENGQYCPFSCETQAWSMAVVLE

GDE_C

GDE_C
PFAM accession number:PF06202
Interpro abstract (IPR032790): This entry represents the C-terminal domain of the glycogen debranching enzyme AGL. AGL is a multifunctional enzyme acting as 1,4-alpha-D-glucan:1,4-alpha-D-glucan 4-alpha-D-glycosyltransferase and amylo-1,6-glucosidase in glycogen degradation [(PUBMED:21585652)]. This a glucosidase domain. Mutations in this region disrupt the glucosidase activity [(PUBMED:11375985)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GDE_C