The domain within your query sequence starts at position 2 and ends at position 84; the E-value for the GFRP domain shown below is 2.8e-47.

PYLLISTQIRMEVGPTMVGDEHSDPELMQHLGASKRSVLGNNFYEYYVNDPPRIVLDKLE
CKGFRVLSMTGVGQTLVWCLHKE

GFRP

GFRP
PFAM accession number:PF06399
Interpro abstract (IPR009112):

GTP cyclohydrolase I feedback regulatory protein (GFRP) in mammals helps regulate the biosynthesis of tetrahydrobiopterin through the feedback inhibition of the rate-limiting enzyme GTP cyclohydrolase I (GTPCHI). Tetrahydrobiopterin is the cofactor required for the hydroxylation of aromatic amino acids. The crystal structure of GFRP reveals that the protein forms a homopentamer [ (PUBMED:11580249) ]. In the presence of phenylalanine, the stimulatory complex consists of a GTPCHI decamer sandwiched by two GFRP pentamers, which is thought to enhance GTPCHI activity by locking the enzyme in the active state [ (PUBMED:11818540) ]. The structure of GFRP consists of two alpha/beta layers arranged beta(2)-alpha-beta(2)-alpha-beta(2), with antiparallel beta-sheets in the order 342165.

GO process:negative regulation of biosynthetic process (GO:0009890)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GFRP