The domain within your query sequence starts at position 2 and ends at position 84; the E-value for the GFRP domain shown below is 2.8e-47.
PYLLISTQIRMEVGPTMVGDEHSDPELMQHLGASKRSVLGNNFYEYYVNDPPRIVLDKLE CKGFRVLSMTGVGQTLVWCLHKE
GFRP |
![]() |
---|
PFAM accession number: | PF06399 |
---|---|
Interpro abstract (IPR009112): | GTP cyclohydrolase I feedback regulatory protein (GFRP) in mammals helps regulate the biosynthesis of tetrahydrobiopterin through the feedback inhibition of the rate-limiting enzyme GTP cyclohydrolase I (GTPCHI). Tetrahydrobiopterin is the cofactor required for the hydroxylation of aromatic amino acids. The crystal structure of GFRP reveals that the protein forms a homopentamer [(PUBMED:11580249)]. In the presence of phenylalanine, the stimulatory complex consists of a GTPCHI decamer sandwiched by two GFRP pentamers, which is thought to enhance GTPCHI activity by locking the enzyme in the active state [(PUBMED:11818540)]. The structure of GFRP consists of two alpha/beta layers arranged beta(2)-alpha-beta(2)-alpha-beta(2), with antiparallel beta-sheets in the order 342165. |
GO process: | negative regulation of biosynthetic process (GO:0009890) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GFRP