The domain within your query sequence starts at position 340 and ends at position 709; the E-value for the GGN domain shown below is 1.5e-165.

VPPGATRPLGEVPRAAQETEGGDGDGEGCSGPPSVPAPLARALPPPPYTTFPGSKPKFDW
VSPPDGTERHFRFNGAVGGIGAPRRRTTTLSGPWGSPPPRSGQTHPSSGPRRPTPALLAP
PMFIFPAPNNGEPVRPVPPSPQQIPPLPPPPPTPPATPPPAPPPTPQPPALPRTPILVAR
PPTPGPGHLESALAPTPPSTLSPTAAADQVPAATPATVTSQVPATATAELSPPMPQPKTR
TRRNKGPRAARGVIREEGTSGDGPREPNTAPVTDSSSGGGGGGSNGTSTAGASNKGTARH
WPPFEVLNSCPCKCYCRHQRRHRRLPRNVSAWLSTPTNHLSEPPWVATVKLAGSLVAGLE
HYDLQATHST

GGN

GGN
PFAM accession number:PF15685
Interpro abstract (IPR031400):

Gametogenetin (GGN) is a family of proteins largely found in vertebrates. GGN reacts with POG in the maturation of sperm [(PUBMED:12574169)] and is expressed virtually only in the testis. It is also expressed in lower levels in the oocyte and is required for the survival of pre-implantation embryos [(PUBMED:23451117)]. GGN plays a role in male meiotic DNA double strand break repair [(PUBMED:23451117)]. It is found to be associated with the intracellular membrane, binds with GGNBP1 and may be involved in vesicular trafficking [(PUBMED:15642376)].

GO process:gamete generation (GO:0007276), double-strand break repair (GO:0006302)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GGN