The domain within your query sequence starts at position 177 and ends at position 519; the E-value for the GH3 domain shown below is 1e-62.

PDGAKDPRTLLLEALISPGLRVLEARTAVELLDVFVGLEADGEELAEAIAAGILGTLLPK
RAAELKEALEQGPRGLARRLWPKLQVVVTLDSGGQAEAVAALRVLWCQGLAFFSPAYAAS
GGVVALNLWPERPQGSYLLPPGVPFIELLPIKEGTQEEAASTLLLTDAQREKEYELVLTN
HTSLTRCRLGDVVQVVGTYNQCPVVRFTCRLGQTLNVRGEVTDETVFSVALAQAVGQWPG
AKLLDHVCVESRVLDSCEGSAPHYEVFVELRGLRNLSEENRDKLDNCLQEASAQYKSLRF
RGSVGPAKVHLVRPGSFRVLREALAAFSSSSCRPPEMPRVIRL

GH3

GH3
PFAM accession number:PF03321
Interpro abstract (IPR004993): GH3 protein was first isolated from Glycine max (soybean) as an early auxin-responsive gene [(PUBMED:4041007)]. Later, several plant GH3 family proteins have been identified and classified into three groups: group I proteins synthesise JA-amino acid conjugates [(PUBMED:21619871)], group II proteins produce indole-3-acetic acid (IAA) conjugates [(PUBMED:15659623)], group III protein are involved in the conjugation of amino acids to 4-substituted benzoate [(PUBMED:19189963)]. This entry also includes proteins from bacteria, fungi and animals.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GH3