The domain within your query sequence starts at position 289 and ends at position 374; the E-value for the GHMP_kinases_C domain shown below is 1.6e-14.

AQAAAAMSRGDYKAFGRLMVESHYSLRDDYEVSCPELDQLVEAALSVPGVYGSRMTGGGF
GGCTVTLLEASVAPLVIDHIQEQYSG

GHMP_kinases_C

GHMP_kinases_C
PFAM accession number:PF08544
Interpro abstract (IPR013750):

This domain is found in homoserine kinases (EC 2.7.1.39), galactokinases (EC 2.7.1.6) and mevalonate kinases (EC 2.7.1.36). These kinases make up the GHMP kinase superfamily of ATP-dependent enzymes [(PUBMED:8382990)]. These enzymes are involved in the biosynthesis of isoprenes and amino acids as well as in carbohydrate metabolism. The C-terminal domain of homoserine kinase has a central alpha-beta plait fold and an insertion of four helices, which, together with the N-terminal fold, create a novel nucleotide binding fold [(PUBMED:11188689)].

This domain is also found in some diphosphomevalonate decarboxylases, which are structurally related members of the GHMP superfamily [(PUBMED:17583736)], but do not possess kinase activity.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GHMP_kinases_C