The domain within your query sequence starts at position 112 and ends at position 167; the E-value for the GHMP_kinases_N domain shown below is 6.8e-7.
HVASVNNFPTAAGLASSAAGYACLAYTLAQVYGVEGDLSEVARRGSGSACRSLYGG
GHMP_kinases_N |
![]() |
---|
PFAM accession number: | PF00288 |
---|---|
Interpro abstract (IPR006204): | The galacto- (EC 2.7.1.6), homoserine (EC 2.7.1.39), mevalonate (EC 2.7.1.36) and phosphomevalonate (EC 2.7.4.2) kinases contain, in their N-terminal section, a conserved domain with a Gly/Ser-rich region which is probably involved in the binding of ATP [(PUBMED:1846667), (PUBMED:10562426)]. This group of kinases has been called 'GHMP' (from the first letter of their substrates). This domain is also found in diphosphomevalonate decarboxylases, which are structurally related members of the GHMP superfamily [(PUBMED:17583736)], but do not possess kinase activity. |
GO function: | ATP binding (GO:0005524) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GHMP_kinases_N