The domain within your query sequence starts at position 552 and ends at position 676; the E-value for the GIT1_C domain shown below is 1e-64.

HSVPSPTLPSTEDVIRKTEQITKNIQELLRAAQENKHDSYIPCSERIHVAVTEMAALFPK
KPKSDTVRTSLRLLTSSAYRLQSECRKALPGDSSLPTDVQLVTQQVIQCAYDIAKAAKQL
VTITT

GIT1_C

GIT1_C
PFAM accession number:PF12205
Interpro abstract (IPR022018):

This entry represents the C-terminal domain of the ARF GTPase-activating protein GIT1. This domain is also found in the budding yeast Spa2 protein.

GIT1 is an ArfGAP and scaffolding protein regulating cell adhesion and migration [(PUBMED:24699139)]. To perform this function, it localises p21-activated kinase (PAK) and PAK-interactive exchange factor to focal adhesions. Its activation is regulated by interaction between its paxillin-binding C-terminal and the LD motifs of paxillin. The C-terminal folds into a four helix bundle.

Budding yeast Spa2 is a component of the polarisome that functions in actin cytoskeletal organisation during polarized growth [(PUBMED:12361575)]. Its paralogue, Sph1, is involved in shmoo formation and bipolar bud site selection [(PUBMED:9443897)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GIT1_C