The domain within your query sequence starts at position 418 and ends at position 483; the E-value for the GIT_CC domain shown below is 8.6e-34.
RSMDSSDLSDGAVTLQEYLELKKALATSEAKVQQLMKVNSSLSDELRRLQREIHKLQAEN LQLRQP
GIT_CC |
---|
PFAM accession number: | PF16559 |
---|---|
Interpro abstract (IPR032352): | This entry represents the coiled-coil region of GIT (G protein-coupled receptor kinase-interacting) proteins. This coiled-coil region is the surface that associates with the equivalent binding-region on beta-PIX, or p21-activated kinase-interacting exchange factor proteins. Both GIT and PIX complex together to form a scaffold for the formation of multi-protein assemblies. On its own the GIT-CC region assembles into a parallel two-stranded CC in the asymmetric unit. Similarly the PIX coiled-coil region assembles into a trimer. At least in vitro the two regions associate together into a stable heteropentameric complex that consists of one PIX trimer and one GIT dimer [ (PUBMED:19136011) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GIT_CC