The domain within your query sequence starts at position 156 and ends at position 186; the E-value for the GIT_SHD domain shown below is 7.9e-19.
AKKKLQSLSNHLFEELAMDVYDEVDRRETDA
GIT_SHD |
![]() |
---|
PFAM accession number: | PF08518 |
---|---|
Interpro abstract (IPR013724): | This entry represents the Spa2 homology domain (SHD) domain found in the yeast Spa2/Sph1 protein and the mammalian GIT proteins. Budding yeast Spa2 is a component of the polarisome that functions in actin cytoskeletal organisation during polarized growth [ (PUBMED:12361575) ]. Its paralogue, Sph1, is involved in shmoo formation and bipolar bud site selection [ (PUBMED:9443897) ]. GIT is a GTPase-activating protein for the ADP ribosylation factor family. It may serve as a scaffold to bring together molecules to form signaling modules controlling vesicle trafficking, adhesion and cytoskeletal organisation [ (PUBMED:11896197) ]. Mutations in the Spa2 homology domain (SHD) domain of GIT1 described here interfere with the association of GIT1 with Piccolo, beta-PIX, and focal adhesion kinase [ (PUBMED:12473661) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry GIT_SHD