The domain within your query sequence starts at position 3 and ends at position 232; the E-value for the GKAP domain shown below is 2.4e-81.

PSSESSAPSHSMSSRRDTDSDTQDANDSSCKSSERSLPDCTSHPNSISIDAGPRQAPKIA
QIKRNLSYGDNSDPALEASSLPPPDPWLETSSSSPAEPAQPGACRRDGYWFLKLLQAETE
RLEGWCCQMDKETKENNLSEEVLGKVLSAVGSAQLLMSQKFQQFRGLCEQNLNPDANPRP
TAQDLAGFWDLLQLSIEDISMKFDELYHLKANSWQLVETPEKRKVSMEQC

GKAP

GKAP
PFAM accession number:PF03359
Interpro abstract (IPR005026):

This entry represents the SAPAP family, whose members include mars from fruit flies and disks large-associated proteins from vertebrates.

Mars binds to microtubules and protein phosphatase 1. It is involved in cell signalling, mitotic spindle organisation and regulation of mitotic cell cycle [ (PUBMED:23593258) (PUBMED:17007873) ]. It is essential for the early development of Drosophila embryos [ (PUBMED:23593258) ].

Disks large-associated proteins are synaptic proteins that may play several roles in the molecular organisation of synapses and neuronal cell signalling [ (PUBMED:9024696) (PUBMED:9286858) ].

GO process:signaling (GO:0023052)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry GKAP